Products

IL-30 (Interleukin-30), Human

Interleukin-30 (IL-30) is a protein with a molecular weight of 28 kilodaltons, which forms one chain of the heterodimeric cytokine called interleukin 27 (IL-27), thus is sometimes called IL27-p28. The other chain of IL-27 is a molecule called Epstein-Barr induced gene-3 (EBI3). IL-30 is a member of the long-chain, 4-helix bundle family of cytokines, making it structurally similar to IL-6. This gene for this molecule is now officially called IL-27 under HGNC guidelines.
No. Size Price Qty Status
C01036-5UG 5 ug $108.00 Inquiry
C01036-20UG 20 ug $268.00 Inquiry
C01036-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGG
LGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELV
LSRAVRELLLLSKAGHSVWPLGFPTLSPQP with polyhistidine tag at the C-terminus

UnitProt ID:
Q8NEV9
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice